PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10022129m
Common NameCARUB_v10022129mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 195aa    MW: 21559.1 Da    PI: 7.9163
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10022129mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.98.7e-33112170159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dp+vv++tYeg Hnh+
  Carubv10022129m 112 LDDGYRWRKYGQKSVKNNAHPRSYYRCTYHTCNVKKQVQRLAKDPSVVVTTYEGVHNHP 170
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.5E-3399170IPR003657WRKY domain
SuperFamilySSF1182901.19E-28104171IPR003657WRKY domain
PROSITE profilePS5081129.126107172IPR003657WRKY domain
SMARTSM007741.4E-38112171IPR003657WRKY domain
PfamPF031061.7E-26113170IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MEGVDNTNPM STLEEGGNNN PFSSFDDKTL MMMAPSLMFS GDVGPSSSSC SPASFHLSAQ  60
LENFQGGGGD VGGLVSNNDS DHINKNCNKG KGKRSQAMQR IAFHTRSDDD VLDDGYRWRK  120
YGQKSVKNNA HPRSYYRCTY HTCNVKKQVQ RLAKDPSVVV TTYEGVHNHP CEKLMETLSP  180
LLRQLQFLSR VSDM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26102169774Probable WRKY transcription factor 4
2lex_A2e-26102169774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0718480.0AY071848.1 Arabidopsis thaliana WRKY transcription factor 56 (WRKY56) mRNA, complete cds.
GenBankBT0248350.0BT024835.1 Arabidopsis thaliana At1g64000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301676.11e-146hypothetical protein CARUB_v10022129mg
SwissprotQ8VWQ41e-120WRK56_ARATH; Probable WRKY transcription factor 56
TrEMBLR0HXN21e-146R0HXN2_9BRAS; Uncharacterized protein
STRINGAT1G64000.11e-117(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.11e-111WRKY DNA-binding protein 56